PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G1369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 342aa    MW: 38033.1 Da    PI: 6.7742
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G1369genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
      Gh_A09G1369 14 KGPWSPEEDAKLKEYIQKHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.89e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Gh_A09G1369  69 GEFSDDEDRIICTLFASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.992962IPR017930Myb domain
SuperFamilySSF466893.48E-2711109IPR009057Homeodomain-like
SMARTSM007175.1E-131364IPR001005SANT/Myb domain
PfamPF002492.9E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-251569IPR009057Homeodomain-like
CDDcd001671.51E-91662No hitNo description
PROSITE profilePS5129421.76863117IPR017930Myb domain
SMARTSM007171.4E-1167115IPR001005SANT/Myb domain
PfamPF002491.7E-1069111IPR001005SANT/Myb domain
CDDcd001676.59E-870113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVRAPCCDKA NVKKGPWSPE EDAKLKEYIQ KHGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDDEDRIIC TLFASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLFGM  120
VPQSQRKPHQ IPHASFSSLL QSSSPSSPSP SSSSPLLYNC SNNTYHTPAR SFSCFEASYS  180
SSFSNSSASC VNAASVLQPQ ESFLGQIQHY QLHDNGVQMF GGETSCSSSD GSCSNQISHN  240
KELENSNGTL YDGDHQQFGM YSYNNFYSEA ADGSQKLMMA LNGDHGTDGW SDHHKSSNGL  300
LDETETPLDY GIEGIKQLIS TTSSCNSFIF YENKEDENLL YY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ1156441e-115HQ115644.1 Gossypium hirsutum DNA-binding transcription factor blind 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485909.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A0D2S4F20.0A0A0D2S4F2_G
STRINGPOPTR_0006s12530.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-76myb domain protein 36